Dataset for protein Bim of organism Chinchilla lanigera

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2UYE1_BCL2L11      TRPGRRRSRQGTRRGQPRLYLSQPARAGSPRGAGAGLALPRAEAGLGGGG
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
                                                                          

A0A8C2UYE1_BCL2L11      ARGDWTRARSRQSELGCRAAQVSLRSAQPLGAELAGAQRPAPSPPPHHRR
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
                                                                          

A0A8C2UYE1_BCL2L11      QRILTVPLRALPHCSQHRLRQLQLPRSRRHRLGALPWPWYPQCLTLILEL
A0A8C2UYE1_BCL2L11      --------------------------------------------------
A0A8C2UYE1_BCL2L11      --------------------------------------------------
                                                                          

A0A8C2UYE1_BCL2L11      RSARKKDQMAKQPSDVSSECDTEGGQLQPAERPPQLRPGALTSLQTEPQD
A0A8C2UYE1_BCL2L11      --------MAKQPSDVSSECDTEGGQLQPAERPPQLRPGALTSLQTEPQD
A0A8C2UYE1_BCL2L11      --------MAKQPSDVSSECDTEGGQLQPAERPPQLRPGALTSLQTEPQ-
                                ***************************************** 

A0A8C2UYE1_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPPDLRPEIWIAQ
A0A8C2UYE1_BCL2L11      RSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPPDLRPEIWIAQ
A0A8C2UYE1_BCL2L11      -----------------------------ASMRQSQAEPPDLRPEIWIAQ
                                                     *********************

A0A8C2UYE1_BCL2L11      ELRRIGDEFNASYPRRVFLNHYQAAEDQPQMVILRLLRYIVRLVWRMH
A0A8C2UYE1_BCL2L11      ELRRIGDEFNASYPRRVFLNHYQAAEDQPQMVILRLLRYIVRLVWRMH
A0A8C2UYE1_BCL2L11      ELRRIGDEFNASYPRRVFLNHYQAAEDQPQMVILRLLRYIVRLVWRMH
                        ************************************************

© 1998-2022Legal notice