Dataset for protein Bim of organism Chelydra serpentina

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3RZA1_BCL2L11      MAKQPSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQGNHTGE
A0A8C3RZA1_BCL2L11      MAKQPSDLNSECNREGGQFQSIERPSQPQHLRPGAPTSIQTQYQ------
                        ********************************************      

A0A8C3RZA1_BCL2L11      GDFAQQPSGSSSPSSPQGPFAPPSSPSPFATRSPLFIFVRRSSLLSRSSS
A0A8C3RZA1_BCL2L11      --------------------------------------------------
                                                                          

A0A8C3RZA1_BCL2L11      GYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRWESPSIREDM
A0A8C3RZA1_BCL2L11      -------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRWESPSIREDM
                               *******************************************

A0A8C3RZA1_BCL2L11      QPEIWIAQELRRIGDEFNASYCPRRVTLFYFIFLIFLKIVWGRGGV
A0A8C3RZA1_BCL2L11      QPEIWIAQELRRIGDEFNASYCPRRVTLFYFIFLIFLKIVWGRGGV
                        **********************************************

© 1998-2022Legal notice