Dataset for protein Bim of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5NTQ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K5NTQ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5NTQ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5NTQ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5NTQ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5NTQ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5NTQ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGG
A0A2K5NTQ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K5NTQ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
A0A2K5NTQ5_BCL2L11      MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------
                        *****************************************         

A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K5NTQ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K5NTQ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K5NTQ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K5NTQ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K5NTQ5_BCL2L11      EGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFD
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
                                                                          

A0A2K5NTQ5_BCL2L11      -DRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPE
A0A2K5NTQ5_BCL2L11      TDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPE
A0A2K5NTQ5_BCL2L11      TDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPE
A0A2K5NTQ5_BCL2L11      TDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPE
A0A2K5NTQ5_BCL2L11      TDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMVREIEEVVV-----
A0A2K5NTQ5_BCL2L11      TDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMGIFE----------
A0A2K5NTQ5_BCL2L11      TDRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMANWD----------
A0A2K5NTQ5_BCL2L11      -ASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARR---LAELLASST--
A0A2K5NTQ5_BCL2L11      -DRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAM----DEATGSSLRI
A0A2K5NTQ5_BCL2L11      -DRSPAPMSCD-----KSTQTPSPPCQAFNHYLSAMVVILEDIGDSSLWF
                              . ..*     . :*      : ** * :                

A0A2K5NTQ5_BCL2L11      IRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVW
A0A2K5NTQ5_BCL2L11      IRIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPQMVILRLLRYIVRLVW
A0A2K5NTQ5_BCL2L11      IRIAQELRRIGDEFNAYYARRLEK--------------------------
A0A2K5NTQ5_BCL2L11      IRIAQELRRIGDEFNAYYARRMSLPPD-----------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      --------------------------------------------------
A0A2K5NTQ5_BCL2L11      AL-----------HREVQWPLECLASS-----------------------
A0A2K5NTQ5_BCL2L11      GFIFTGLDLYGHHHSQDTEQLNHKDFS-----------------------
                                                                          

A0A2K5NTQ5_BCL2L11      RMH
A0A2K5NTQ5_BCL2L11      RMH
A0A2K5NTQ5_BCL2L11      ---
A0A2K5NTQ5_BCL2L11      ---
A0A2K5NTQ5_BCL2L11      ---
A0A2K5NTQ5_BCL2L11      ---
A0A2K5NTQ5_BCL2L11      ---
A0A2K5NTQ5_BCL2L11      ---
A0A2K5NTQ5_BCL2L11      ---
A0A2K5NTQ5_BCL2L11      ---
                           

© 1998-2021Legal notice