Dataset for protein Puma of organism Cebus imitator

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5QNS7_BBC3-01      MKCGVGSAWACPCQVPRASSSVWVPCQMCGPRERHGPRTPGGQLPGARRG
A0A2K5QNS7_BBC3-02      MKCGVGSAWACPCQVPRASSSVWVPCQMCGP-------------------
A0A2K5QNS7_BBC3-03      MKCGVGSAWACPCQVPRASSSVWVPCQMCET-------------------
                        ***************************** .                   

A0A2K5QNS7_BBC3-01      PGPRRPAPLPARPPGALGRVLRPLRVRPARRPCRPRLAARCLPLRPRHPT
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
                                                                          

A0A2K5QNS7_BBC3-01      RRHRRPGEPPLAWGPPQPPPRPAPGRSSALALAGGAAPGVARAQRPGGPG
A0A2K5QNS7_BBC3-02      --------------------------------------------------
A0A2K5QNS7_BBC3-03      --------------------------------------------------
                                                                          

A0A2K5QNS7_BBC3-01      GRSHPGGPGSPRGGGAVGPGDRGPAAADGGRPQRAVRAAETRGAAAAPPL
A0A2K5QNS7_BBC3-02      -----------------------------------------QPSLSLAEQ
A0A2K5QNS7_BBC3-03      -----------------------------------------RGAAAAPPL
                                                                 . : : .  

A0A2K5QNS7_BBC3-01      ALEGPVQSHHGTPALSQGPQ-------------SPRDGAQLGACTCPVDV
A0A2K5QNS7_BBC3-02      HLESPVPSAPG--ALAGGPTQAALGVRGEEEQWAREIGAQLQRMADDLNA
A0A2K5QNS7_BBC3-03      ALEGPVQSHHGTPALSQGPQ-------------SPRDGAQLGACTCPVDV
                         **.** *  *  **: **              :   ****   :  ::.

A0A2K5QNS7_BBC3-01      RDSGGRPLPPPDTLASAGDFLCTM-------------------
A0A2K5QNS7_BBC3-02      QYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPEMEPN
A0A2K5QNS7_BBC3-03      RDSGGRPLPPPDTLASAGDFLCTM-------------------
                        . .  *    *:  .*.  .* .:                   

© 1998-2021Legal notice