Dataset for protein Bmf of organism Cavia porcellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A286XXB0_BMF-03      -----------------------------------------------VFP
A0A286XXB0_BMF-02      MPGAGVFWKQYRARRRRRGPDPPRVFVTLDPGTEPWHHDSEADSLSWSHP
                                                                       .*

A0A286XXB0_BMF-03      REMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLH
A0A286XXB0_BMF-02      GEMEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLGRLH
                        *************************************************

A0A286XXB0_BMF-03      LFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYG
A0A286XXB0_BMF-02      LFPLTHCCGPGLRPTSQEDKATQTLSPSSPSQGVMLPCGVTEEPQRLFYG
                       **************************************************

A0A286XXB0_BMF-03      NAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLH
A0A286XXB0_BMF-02      NAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLH
                       **************************************************

A0A286XXB0_BMF-03      IQQHQQNRNRAWWQVLLFMHNLGLNGEENREGAGPR
A0A286XXB0_BMF-02      IQQHQQNRNRAWWQVLLFMHNLGLNGEENREGAGPR
                       ************************************

© 1998-2020Legal notice