Dataset for protein classical BH3-containing proteins of organism Catharus ustulatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3UF02_BAD-01       -------------------GEEGGGGAGGGAGGGAGGGA-----------
A0A8C3V2X5_PMAIP1-      MLPGRTLRKAAPPA-----APAGTGGGRARGEGGTGRDGDTPPCAPALLP
A0A8C3VHE5_BMF-01       --------MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAG-----------
A0A8C3TPU0_BCL2L11      -------MAKQPPEVK---ARRDGEGGRLPAAEGPGPGAQLRPGAPAALP
A0A8C3TPU0_BCL2L11      -------MAKQPPEVK---ARRDGEGGRLPAAEGPGPGAQLRPGAPAALP
A0A8C3TPU0_BCL2L11      -------MAKQPPEVK---ARRDGEGGRLPAAEGPGPGA-----------
A0A8C3TPU0_BCL2L11      -------MAKQPPEVK---ARRDGEGGRLPAAEGPGPGA-----------
                                           .  .  .       . *  .           

A0A8C3UF02_BAD-01       --------------------------------------------------
A0A8C3V2X5_PMAIP1-      GSSTALAASARGGCGHPAQARGIQLLFPA------------------SGQ
A0A8C3VHE5_BMF-01       -------QPGEMTATGFFTQNQSYSCLLGRFQLFPLTHCCGPGV---RHP
A0A8C3TPU0_BCL2L11      GAGAVSAARGPPASPGPFATRSPLFIFVRRSPLLPRSSSGYFSFDAERSP
A0A8C3TPU0_BCL2L11      GAGAVSAARGPPASPGPFATRSPLFIFVRRSPLLPRSSSGYFSFDAERSP
A0A8C3TPU0_BCL2L11      --------------PGPFAT---------------------------RSP
A0A8C3TPU0_BCL2L11      --------------PGPFAT---------------------------RSP
                                                                          

A0A8C3UF02_BAD-01       ------------GDPPAH--------------------------------
A0A8C3V2X5_PMAIP1-      ERARGGVCFTMRKKLKNRAKSTVLAKAVT---------------------
A0A8C3VHE5_BMF-01       EQQ---DKATQTLSPSSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAG
A0A8C3TPU0_BCL2L11      APALGCDKATQTPSPPCQALSHCLSAMAS---------------------
A0A8C3TPU0_BCL2L11      APALGCDKATQTPSPPCQALSHCLSAMAS---------------------
A0A8C3TPU0_BCL2L11      APALGCDKATQTPSPPCQALSHCLSAMAS---------------------
A0A8C3TPU0_BCL2L11      APALGCDKATQTPSPPCQALSHCLSAMGK---------------------
                                     .                                    

A0A8C3UF02_BAD-01       -------RGRSRSAPPVLWAAQRYGRRLRRMSDEFQLQVLPRPRSVGGAP
A0A8C3V2X5_PMAIP1-      ----------RRVSAGREAAAAECALELTRIGDRWN--------------
A0A8C3VHE5_BMF-01       FVLDPHLQEEPQEGQREARAEVQIARKLQCIADQFHRLHIQRHQQNRNQV
A0A8C3TPU0_BCL2L11      -------RWQSRSPAEEVQPEIWIAQELRRIGDEFNASYGPRRLPHCSQA
A0A8C3TPU0_BCL2L11      -------RWQSRSPAEEVQPEIWIAQELRRIGDEFNASYGPRRGFLDQQV
A0A8C3TPU0_BCL2L11      -------RWQSRSPAEEVQPEIWIAQELRRIGDEFNASYGPRRG-RDQAV
A0A8C3TPU0_BCL2L11      -------LRANGKSSVLCHRDSWIHPGRLSWEHRAAELFYPHPG-LQLSL
                                                                          

A0A8C3UF02_BAD-01       PWG-----RGWRETLRAWWGRRPSPPAPPP
A0A8C3V2X5_PMAIP1-      ------LRQRILNLFLVTWGDLGQD-----
A0A8C3VHE5_BMF-01       WWQLFLFLHNLALNTEVNRNHTGQR-----
A0A8C3TPU0_BCL2L11      WLAVILLFLHLLHFSQMAW-----HS----
A0A8C3TPU0_BCL2L11      GNPQVVILRLLRYIIRLIW-----RLQ---
A0A8C3TPU0_BCL2L11      GNPQVVILRLLRYIIRLIW-----RLQ---
A0A8C3TPU0_BCL2L11      GNTHGFALHTSS--IPVPWQCPAGRVP---
                                          .           

© 1998-2023Legal notice