Dataset for protein classical BH3-containing proteins of organism Catharus ustulatus

[Download (right click)] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C3VHE5_BMF-01          MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGFFTQNQSYSC
A0A8C3V2X5_PMAIP1-01       MLPGRTLRK---------------------AAPPAAPAG-----------
A0A8C3TPU0_BCL2L11-01      MA----------------------------KQPPEVKARR----------
A0A8C3TPU0_BCL2L11-03      MA----------------------------KQPPEVKARR----------
A0A8C3TPU0_BCL2L11-04      MA----------------------------KQPPEVKARR----------
A0A8C3TPU0_BCL2L11-02      MA----------------------------KQPPEVKARR----------
A0A8C3UF02_BAD-01          --------------------------------------------------
                                                                             

A0A8C3VHE5_BMF-01          LLGRFQLFPLTHCCGPGV-------------------------RHPEQ--
A0A8C3V2X5_PMAIP1-01       --TGGGRARGEGGTGRDGDTPPCAPALLPGSSTALAASARGGCGHPAQAR
A0A8C3TPU0_BCL2L11-01      -DGEGGRLPAAEGPGPGAQLRPGAPAALPGAGAVSAARGPPASPGPFATR
A0A8C3TPU0_BCL2L11-03      -DGEGGRLPAAEGPGPGAQLRPGAPAALPGAGAVSAARGPPASPGPFATR
A0A8C3TPU0_BCL2L11-04      -DGEGGRLPAAEGPGPGA-------------------------PGPFATR
A0A8C3TPU0_BCL2L11-02      -DGEGGRLPAAEGPGPGA-------------------------PGPFATR
A0A8C3UF02_BAD-01          --GEEGGGGAGGGAGGGA---------------GGGAGDPPAHRG-----
                                         * .                                 

A0A8C3VHE5_BMF-01          ----------------------------------QDKA------TQTLSP
A0A8C3V2X5_PMAIP1-01       GIQLLF------------------------PASGQERARGGVCFTMRKKL
A0A8C3TPU0_BCL2L11-01      SPLFIFVRRSPLLPRSSSGYFSFDAERSPAPALGCDKA------TQTPSP
A0A8C3TPU0_BCL2L11-03      SPLFIFVRRSPLLPRSSSGYFSFDAERSPAPALGCDKA------TQTPSP
A0A8C3TPU0_BCL2L11-04      ---------------------------SPAPALGCDKA------TQTPSP
A0A8C3TPU0_BCL2L11-02      ---------------------------SPAPALGCDKA------TQTPSP
A0A8C3UF02_BAD-01          --------------------------------------------------
                                                                             

A0A8C3VHE5_BMF-01          SSSSQDVMLPCGVTEEPRRLFYGSAGYRLHVPPAGFVLDPHLQEEPQEGQ
A0A8C3V2X5_PMAIP1-01       KNRAKSTVLAKAVTRR----------------------------V---SA
A0A8C3TPU0_BCL2L11-01      PCQALSHCLSAMASRW----------------------------QSRSPA
A0A8C3TPU0_BCL2L11-03      PCQALSHCLSAMASRW----------------------------QSRSPA
A0A8C3TPU0_BCL2L11-04      PCQALSHCLSAMGKLR----------------------------ANGKSS
A0A8C3TPU0_BCL2L11-02      PCQALSHCLSAMASRW----------------------------QSRSPA
A0A8C3UF02_BAD-01          --------------------------------------------RSR---
                                                                             

A0A8C3VHE5_BMF-01          REARAEVQIAR----KLQCIADQFHR--LHIQRHQQ-NRNQVWWQL-FLF
A0A8C3V2X5_PMAIP1-01       GREAAAAECAL----ELTRIGDRWNL--RQ--------------------
A0A8C3TPU0_BCL2L11-01      EEVQPEIWIAQ----ELRRIGDEFNA--SYGPRRGFLD-QQVGNPQVVIL
A0A8C3TPU0_BCL2L11-03      EEVQPEIWIAQ----ELRRIGDEFNA--SYGPRRLP-HCSQAWLAVILLF
A0A8C3TPU0_BCL2L11-04      VLCHRDSWIHP----G--RLSWEHRAAELFYPHPGL-Q-LSLGNTHGFAL
A0A8C3TPU0_BCL2L11-02      EEVQPEIWIAQ----ELRRIGDEFNA--SYGPRRGR-D-QAVGNPQVVIL
A0A8C3UF02_BAD-01          -SAPPVLWAAQRYGRRLRRMSDEFQL--QVLPRP-----RSVGGAP-PWG
                                              :. . .                         

A0A8C3VHE5_BMF-01          LHNLALNTEVNRNH-----TGQR
A0A8C3V2X5_PMAIP1-01       RILN-LFL-VTWGD-----LGQD
A0A8C3TPU0_BCL2L11-01      RLLRYIIR-LIW--------RLQ
A0A8C3TPU0_BCL2L11-03      LHLLHFSQ-MAW--------H-S
A0A8C3TPU0_BCL2L11-04      HT--SSIP-VPW---QCPAGRVP
A0A8C3TPU0_BCL2L11-02      RLLRYIIR-LIW--------RLQ
A0A8C3UF02_BAD-01          RGWRETLR-AWWGRRPSPPAPPP
                                                  

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice