Dataset for protein Bim of organism Catagonus wagneri

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C3X5Q0_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---------
A0A8C3X5Q0_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQ---------
A0A8C3X5Q0_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDR
A0A8C3X5Q0_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDR
A0A8C3X5Q0_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDR
                        *****************************************         

A0A8C3X5Q0_BCL2L11      --------------------------------------------------
A0A8C3X5Q0_BCL2L11      -----------------------------------------------DRS
A0A8C3X5Q0_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C3X5Q0_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C3X5Q0_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                          

A0A8C3X5Q0_BCL2L11      ---------------------------ASMRQSQAEPADMRPEIWIAQEL
A0A8C3X5Q0_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQEL
A0A8C3X5Q0_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQEL
A0A8C3X5Q0_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQEL
A0A8C3X5Q0_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAEPADMRPEIWIAQEL
                                                   ***********************

A0A8C3X5Q0_BCL2L11      RRIGDEFNAYYPRR-------LAECLAFCT----------------
A0A8C3X5Q0_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEAHPQMVILRLLRYIVRLVWRMQ
A0A8C3X5Q0_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEAHPQMVILRLLRYIVRLVWRMQ
A0A8C3X5Q0_BCL2L11      RRIGDEFNAYYPRRGYCVCENPASCWTRRD----------------
A0A8C3X5Q0_BCL2L11      RRIGDEFNAYYPRR-------------LEQ----------------
                        **************                                

© 1998-2022Legal notice