Dataset for protein Bmf of organism Castor canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0XK68_BMF-02      -----------------------------------------IFSGELEPP
A0A8C0XK68_BMF-01      QLGFFPPSQSSLGAKPPRVLVTLDPGAEPWHHDSEAETLPWSHPGELEPP
                                                                 ..******

A0A8C0XK68_BMF-02      QCVEELEDDVFQAEDGEPGTQPGRLLSADLFAQSQLDCPLGRLQLFPLTH
A0A8C0XK68_BMF-01      QCVEELEDDVFQAEDGEPGTQPGRLLSADLFAQSQLDCPLGRLQLFPLTH
                       **************************************************

A0A8C0XK68_BMF-02      CCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRL
A0A8C0XK68_BMF-01      CCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRL
                       **************************************************

A0A8C0XK68_BMF-02      PLPASFPAGLVLGEQPPEGQWPHRVEVQIARKLRCIADQFHRLHVQQRQQ
A0A8C0XK68_BMF-01      PLPASFPAGLVLGEQPPEGQWPHRVEVQIARKLRCIADQFHRLHVQQRQQ
                       **************************************************

A0A8C0XK68_BMF-02      HRDRAWWQILLFLHNLALNRGENRDGAGPR
A0A8C0XK68_BMF-01      HRDRAWWQILLFLHNLALNRGENRDGAGPR
                       ******************************

© 1998-2023Legal notice