Dataset for protein Noxa of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C2P9C6_PMAIP1-      ---RRARRSAQP-SPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLIAKL
A0A452EST2_PMAIP1-      MPGRRARRSAQP-SPTRVPADPEVECAIQLRRIGDKLNFRQKLVNLIAKL
A0A8C2R6N9_PMAIP1-      QTGGWGLCSSQPLDPLK---NPEVECAIQLRRIGDKLNFRQKLVNLIAKL
                            ..  *:** .* .   :*****************************

A0A8C2P9C6_PMAIP1-      LRSGT
A0A452EST2_PMAIP1-      LRSGT
A0A8C2R6N9_PMAIP1-      LRSGT
                        *****

© 1998-2022Legal notice