Dataset for protein Bim of organism Canis lupus dingo

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C0L5G0_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A8C0L5G0_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
                        *****************************************         

A0A8C0L5G0_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A8C0L5G0_BCL2L11      -----------------------------------------------DRS
                                                                       ***

A0A8C0L5G0_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQEL
A0A8C0L5G0_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQEL
                        **************************************************

A0A8C0L5G0_BCL2L11      RRIGDEFNAYYPRRVMMFYLLLLLTPSPSPQFFFFKVTSKNSILILEMQG
A0A8C0L5G0_BCL2L11      RRIGDEFNAYYPRRV---FLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ-
                        ***************   :*    :... **::::.:      *:  :* 

A0A8C0L5G0_BCL2L11      ITYM
A0A8C0L5G0_BCL2L11      ----
                            

© 1998-2023Legal notice