Dataset for protein Puma of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5F6X4_BBC3-03      -----SAWACPCQVPRASSSTWVPCQMCGPRERHGPRTPGGQLPGARRGP
A0A2K5F6X4_BBC3-01      KCGVGSAWACPCQVPRASSSTWVPCQMCET--------------------
A0A2K5F6X4_BBC3-02      KCGVGSAWACPCQVPRASSSTWVPCQMCGP--------------------
                             *********************** .                    

A0A2K5F6X4_BBC3-03      GPRRPAPLPAAACDVSPPAATRRTAAWPRGLGGSPQPPPRPAPGREGPEA
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
                                                                          

A0A2K5F6X4_BBC3-03      RRNWRRPGGPGGRSHPGGPGSPRGGGAVGPGDRGPAAADGGRPQRAVRAA
A0A2K5F6X4_BBC3-01      --------------------------------------------------
A0A2K5F6X4_BBC3-02      --------------------------------------------------
                                                                          

A0A2K5F6X4_BBC3-03      ETRGAAAAPPLTLEGPVQSHHGTPALSQGPQSPRDGA---------QLGA
A0A2K5F6X4_BBC3-01      --RGAAAAPPLTLEGPVQSHHGTPALSQGPQSPRDGA---------QLGA
A0A2K5F6X4_BBC3-02      --QPSLSLAEQHLESPVPSAPG--ALAGGPTQAAPGVRGEEEQWAREIGA
                          . : : .   **.** *  *  **: ** ..  *.         ::**

A0A2K5F6X4_BBC3-03      CTRPV--------DVRDSGGRPLPPPDTLASAGDFLCTM-----------
A0A2K5F6X4_BBC3-01      CTRPV--------DVRDSGGRPLPPPDTLASAGDFLCTM-----------
A0A2K5F6X4_BBC3-02      QLRRMADDLNAQYERRRQEEQPQHRPSPWRVLYNLIMGLLPFPRGHRAPE
                          * :        : * .  .*   *..     :::  :           

A0A2K5F6X4_BBC3-03      ----
A0A2K5F6X4_BBC3-01      ----
A0A2K5F6X4_BBC3-02      MEPN
                            

© 1998-2020Legal notice