Dataset for protein Bad of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5E6A6_BAD-03      MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGDASH
A0A2K5E6A6_BAD-01      MFQIPEFEPSEQEDSSSAERGLSPSTAGDRPPGSGKHPRQAPGLPGDASH
                       **************************************************

A0A2K5E6A6_BAD-03      QQGQPTSSSHHGGEYSTCASASSSENPSARMLSKASAGMSAPATDSENVK
A0A2K5E6A6_BAD-01      QQGQPTSSSHHGGAGAVETRSRHSSYPAG---TEEDEGMEEEPSPFRGRS
                       *************  :. : :  *. *:.   :: . **.  .:   . .

A0A2K5E6A6_BAD-03      LEVP--CWVATAPTPQGRRRT----KGWRRSPAPFGAVRAQHPPTSGQHS
A0A2K5E6A6_BAD-01      RSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWT
                        ..*   *.*     : ** :    ..:.  * * .*  * :   *...:

A0A2K5E6A6_BAD-03      AMAAS-------SGG-----
A0A2K5E6A6_BAD-01      QVIQSWWDRNLGRGGSAPSQ
                        :  *        **     

© 1998-2020Legal notice