Dataset for protein classical BH3-containing proteins of organism Anas platyrhynchos

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8B9T738_BCL2L11-02      GGAGKHGAGTGRDGRGGQRQPRARSPLLSRSSSGYFSFEAERSPAPMSCD
A0A8B9T738_BCL2L11-01      GGAGKHGAGTGRDGRGGQRQPRARSPLLSRSSSGYFSFEAERSPAPMSCD
                           **************************************************

A0A8B9T738_BCL2L11-02      KATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPEIWIAQELRRIGDEF
A0A8B9T738_BCL2L11-01      KATQTPSPPCQAVSHYLSAMASRWRSHSLAEEIQPEIWIAQELRRIGDEF
                           **************************************************

A0A8B9T738_BCL2L11-02      NASYCPRR-----------VIFLFLLSISLHLVSKRENPSTLPFPRLWEE
A0A8B9T738_BCL2L11-01      NASYCPRRGFLDNHVGNPQVIILRLLHYIIRLIWRMQ-------------
                           ********           **:* **   ::*: : :             

A0A8B9T738_BCL2L11-02      ESEVEALVTTC
A0A8B9T738_BCL2L11-01      -----------
                                      

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice