Dataset for protein E1B 19K of organism Human adenovirus 43

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
  :* :: .::**     :* :  : *** .                                 *: . .:*    .  :
lme ssiladf  vltsma glkedr   cntgmmteltaslmnrkrperitwhelqqecrdei fmqdkf leliklhw

       170       180       190       200       210       220       230       240
 . .:*::* :::     *  **.  : .::*: * . :.    * *: :** *:      *:   *: ::.        
lnpde we afekyakia fp  kyglldsl ig aalfqgnga r ids  f afgccma maag flmdkmifmnmkf

       250       260       270       280       290       300       310       320
         :  ::*:*      : ::  .  :* * .. ** .: . *:                     *  :: *  
ngekfngvlfmans l ldgcsffgfdfmaael g waki  ckflgc lgvvgrpksemsvkqcvfekcy gpaae la

       330       340       350       360       370       380       390       400
*:.. :*:                                                                        
 lhhcs letgcfclvkgtasikhnvvkgctdermynmltcdsgvchilknihvtsharkkwpvfennllikchmhlgar

       410       420       430       440       450       460       470       480
                                                                     : **:*     
rgtfqpyqcnfsqtklllendafsrvnlngifdmdvsvykilrydetrsrvracecggrhtrmqpvaldle  l eahde

 . :* : ..* *: *
macs ldfpp e dl 
© 1998-2022Legal notice