Dataset for protein BCL-2-like of organism Xiphophorus maculatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                  .         : .                                 
 mys-----l-- kf       p qhl-rs-ppg ran-eetsr ad                              eqr
 asr     e                i p   ad c l a                                     dgi

        90       100       110       120       130       140       150       160
             *  *                                                  .:.  . :.   :
rvrhrsd-----l cs rq-pd--------gasnqvldndttelissflrdftglskcrwgqnkakvalrdtvreflrry
 lncanptpnpts sk  r qagsmstvea                                  --av   l q v ll 
 e   a hfa p   e      apaagmd                                          a     a  

       170       180       190       200       210       220       230       240
   :: :               .  : :.:. .*  ****:..:.:*.. :.    :.  .  *                
trsyksmsstlakdnestamsffrtiaesvvrg it    vagmva aavvaqqckqktmenc sdsgkqqelqqepvsc
sqr hh hqqf hhcgd lcqnlkn l  m k  hf      a      i  re r qngkep p               
qa   d alg  d   a   h  ek      g                     d        a               

       250       260       270       280       290       300       310    
  :   :: **  :   *: .:..*: * . :      :      . ::     :.    *  :          
rliarkmsv  danlsp vakqgs dr as-ygrn-resaesrrsqesfvnwlllavava glfvvvrvaq--l
 alv t ad  ekhkk  iee       cnl aqd    sqg smktnk a   mslv ffiarsifkksy 
              ie              i  g       d  f    k      i      grfc e f 
© 1998-2020Legal notice