Dataset for protein BCL-2-like of organism Ursus maritimus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    :  .   :               . .. 
--------------------------------------g-mmtpcefpytralvqdyvkyklrq--------pgpgpap-
mhteippasarpmshrpspagarliwpxxxxxxxxxxg-wkareasagd-ltiaanfsghvaqikgyvcgagrqensvag
 sqsnrelvvdfl ykl qk   ys sqfsdvehnrttayen d-----p-- nmkpiw l ss         aydg t 
                               maeagre pdg  s met s   g   h   d           v     
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  .:* ......    . :     .: :..  :*   *  * :: * .*  ****:*::* * .
-------------srvhqalRdagdefetryrrtfsdllsqlhvtpg-sArqrFtqVveelFrdG-vNWGRiVafFvFgg
hsssldarevipmdplslvm avassvqgeveknlkpcadsfdlvsvdt qti nt sdke qg ip    l ti a ea
             pvak t  q   d sr f  d aemta   i    ygs  m  e   i         s   
             aa      e      l    a    s                                   e   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :  : ::  :.  *.  .:  ::. ::  .:  **...***                                      
alcvesvnkemsplVd--risywmaeylttrlreWIrsnGGWeleapl-arvrgmeeragklrelr-evg----------
imtkkllqerievd gasqvqefvvafinrnmad  qqs   v---ikygsnkelkvesewrkfrqwvmekqmnmspppg
v  a   d q   s  n at  tt  edh ht  he    stlv-s enaskfhssnpretingnslt          
                     l          ep   d    dgfred  f aac rkklq s  e faa          
                                            ap    c   a p   g      a            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
nagpvimsieekmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslalde
                                                                                
                                                                                
                                                                                

       330       340       350       360       370       380       390  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
                                                                        
-------------------------------------------------------grvyrgsvretsw----
slfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrfysgfnsrprtmtvqsrala---fsry
                                                       klsgmfvtdlqyyylpk
                                                        ileg ql kpgl    
                                                        fcaa     g k    
© 1998-2020Legal notice