Dataset for protein Bcl-xL of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************* *****.*:*******************:****.*
MSYYNRELVVFFIKYKLSQRNYPYNHIEFTEDTNRTDAAEGNDDEaAAGTTnLiNGSLNGTSTGSTGTPPRSPtSTPQhQ
                                             e     t v                   a    r 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
TNGTGGLDAVKEALRDSANEFELRYSQAFNDLSSQLHITPATAYQSFESVMDEVFRDGVNWGRIVGLFAFGGALCVECVE
                                                                                

       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
********.**:*******************************.***************.********* *********
KEMSPLVGsIAeWMTVYLDNKIQPWIQSQGGWERFAEIFGKDAvAESRKSQENFKKWLLvGMTLLTGVVvGSLIAQKRL
        n  d                               a               a         g         
© 1998-2020Legal notice