Dataset for protein BCL-2-like of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     :  .       
--------------------------------------------------------m-qt-----dnrelvvdylsykLs
mfglrrnaviglnlycggaslgagggspagtrslfglcqyrsyiyvslsslplsrv-smsprtgy-thsiaanfiqrvar
                               mlaaeeakafregggeaal  gaaavaaadpstpyipavtmkavhfl q
                                                        rmrpgcefmrd r les eg c k
                                                           g avqde  d  t   r    
                                                              l a          l    
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qkgy-wsqpsdve--------p--------pe---------------------vgaagp--sp-a--------vh-----
vpafse-af---senrteima-eetifsfe--retpsaingnpswrlsdspav------ss--d-revipmda--hqsle
srnte-d--dkt-aplra  s tpgldgcq  snstppvhrdtaahtaplrplncgt hglglvpppeeedavlk     
a  lpavtgteda sag       e       vlrmr avlpmle v eaakssatd sae ta       pp y     
    l pp esm    a                 pk      l            n   lp  p        e       
       l  a                                                                     
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                               .:              :     .               :          
------------------------------qalrragdeferryrrafsdltsqlhvtp-gtarqsFeqVveelFrdGv-
iisrylreqatgskdakplgeagaagrralrtmqevafsvqlevekdlkpmlrdfqiesifsvyirattlmnkeqeg-pi
                              lv lasvtdqstqfhtt aeysdkydlnrleldqgi nr sdnv q- it
                              e       g iknh qn qnsaa   gkn dd vkm ae lthd k  -f
                              a          q e    fg f           t   s   s        
                                                                   d            
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****:* :: * . :                          :   :   :      *:    **                
NWGRiVaffsFGgalc--------vesvnkemqplvd---qiaswmatylnrhlepWiqenGGW-dgftelygp------
    l tlla vavmlnqdrtvkrkklpdrqievdrstykrvslfvtefimdrtrd lhssr  evrtvpkfe-salees
      miiv   tvm        ardqqerqsleigc  nlqdslvnv etnkht  vqq    ae ckfvcnpmvcla
         e   f a        rh ksnnllsc e   p veliydr vnthge  edh     a  a  kdglra  
                         g  ri  g       l         tg  as   k      t  q  hvqda   
                                a                          a         d    n     
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------plweggwlsvlt-lsgalv-gflltvga-fg-k----------------------------------------
rveipnc--psssmvvlr-vytliwpmlatvaqhyy--s-ddpvfkepvffilatlvapqfhsfvpisrqrktacvftwl
skgqerfrfrkpn-rtfkqmtgkdvelfmcikpvvnlanl                                      fs
       nrfdf-ia-edil----iav  gtillifwkhi                                        
         -p-f -r--ldiravatc  a  yf r  c                                         
          f    n   afa   s      i  l                                            
                         g      g  i                                            

  
..
  
--
kt
rk
  
  
  
  
© 1998-2022Legal notice