Dataset for protein BCL-2-like of organism Rattus norvegicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------m-qt------nrelvvdylsykls
mfglrrnaviglnlycggaslgagggspagtrslfglcqyrsyiyvslsslplsrv-smsprtgydthsiamkfih-v-r
                               mlaaeeakafregggeaal  gaaavaaagpstpyi-a--an-vqr-aq
                                                        rm--dcefmr-p-vte-a-gfl -
                                                          rp avqded r l-s e- c k
                                                           g  l a   d  t   r    
                                                                           l    
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
qkgy-wsqpsdve-------ap--------pe-----a---------------vgaagp--sp-a--------vh-----
vpafs---f---senrteim--eetifsfe--retps-ingnpswrlsdspav------ss--d-revipmaa--hqsle
-r--eeda-ded-aplra  s tpgldgcq  snrtppvhrdtaahtaplrplnatt halglvpppeeedpvlk     
s-ntpavtgtkta sag       e       vlsmr avlpmle v eaaksscgd sge ta       dp y     
a  ll pp esm    a                 pk      l            n   lp  p        e       
       l  a                                                                     
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------qalrragdeferryrrafsdltsqlhitp-gtarqsfeqvveelfrdgv-
iisrylreqatgskdakplgeagaagrralltmqevafsvslevekdlaemsrdf-vesifs-ygr-at-mnke-e---i
                              rv--a---d-qt-f--t-kpyld--ql--le-vqiiat-lsd--qqg pt
                              -- l-svt-q-kq-htn ---aakyd-nr dld--- nr --nv -  if
                              e       g i-nh q- qns--   gkn -d vkm -e lthd k    
                              a          q e    fg f           t   s   s        
                                                                   d            
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     * :: * . :                          :   :   :      *:    **                
NWGRiVaffsFGgvlc--------vesvnkemsplvd---riaswmatylnrhlhtWiqenGGW-dgftelyg---p---
----l tlle vaamlnqdrtvkrkklpdrqiqvdrstykqvslfvtefimdrtep lhdsr  evrtvpkfcnpldgal
    x miia   tvm        ardqqerqeleigc  nlqdslvnv etnkrd  vsq    aa--kfve   -qd 
         v   f a        rh ksnnllsc e   p veliydr vnthge  eqh    -e ca---   v   
                         g  ri  g       l         tg  as   k      -  -  k   n   
                                a                          a      t  q  h       
                                                                     d          
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---r-l-------------pgmwvgalvtvGailgsk-------------------------------------------
esm-r-ssvswpslptwltslavlediiylrdypahlflpkvnygniddpvfkepvffilatlvapqfhsfvpisrqrkt
 plvpnfdfeilnckflslksvl-tgcd-s kffsmtlilgqhfiwkcl                               
 eaiceregnqarvrrvf gagarafv-mt slwef-irtaif                                     
 ngaa  rkg e fn    ----f---qli  g vyf a                                         
 g                 v lt rl ag   c  r                                            
                   t f             e                                            
                                   c                                            

         
....:....
         
---------
acvftwlkt
         
         
         
         
         
         
© 1998-2022Legal notice