Dataset for protein Bcl-w of organism Propithecus coquereli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**:.*:*. : . ...  .   *..  * ***         * *  .: * .    .*:                     
MAtpAsApdtrglvggrvsyplRrrhyVpGAG--------pGeGpygnpLhsemrepGd----------efetrfrrtfs
  aa a aaaaaaaadfgggkg qkgl c   geagegapg a daadg eqaelaa elllepepepe-----------
                                                                     pe epp prap

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               .  : .  *.:*.*. * :                                              
dlaaqlhvtpgsaqqrftqvspgLvqGgPnwGrl---------------------------------------------g
---------------qeeeeede fe d gd aivaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihsse
pg pgpgpgs apgs                                                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.   *          *** .*.*               ** ..*            *:: .* *  ** .          
gwelEaikarvremeEEAekLkElqnevekqmnmspppGNagpVimsieekmeadaRsiyvGnVdyGAtaeeleahfhgc
dpa- ftalygdgal   rr r ---------------  was ------------ tvlt a al  lvt---------
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
gsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqik-------------vipkrtnrpgisttdrgfp
------------------------------------------------vslcfplyilysq-------------------
                                                                                

       330       340       350       360    
....:....|....:....|....:....|....:....|....
                                    . ::::. 
raryrarttnynssrsrfysgfnsrprgrvyrgraratswyspy
------------------------------------vgaffask
                                            
© 1998-2022Legal notice