Dataset for protein BCL-2-like of organism Poecilia formosa

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                           .           :  .                          .          
               mhgggdgmssrc    lpevkmgaaklhcphilpkep dnl agaaa daamdeedsld nde
                      amhm     e   af         g d                     daag   had

        90       100       110       120       130       140       150       160
     .            .  .  . .:     : .  :    :       :.              ..:  *:::    
lslrspp---lvnswagsaqqqretsptmrkvsqqtekqhtmrlirsfsqnltgchtqcr---n--lqtmrr vedvlsk
 rfpc hnas         ppdqdpd sgmdlanl  dndqe  hlraqgf nd gsk hwsqdk c nlen l      
 dcn               gk ea    a     d  a a a      l a     ld d   a       k        

       170       180       190       200       210       220       230       240
                              :. .*  ****:*.:.:*.. :.     .     .               
hryayngmlnrlaldnqpdnmgfvtevaenvvsk tt    i gmvt aavva-h---knrreqtglnpgpdsgkqqelq
                              m r  hf      a      i  qelkq gle c ek             
                                g                   d    e     a              

       250       260       270       280       290       300       310       320
        : : :: ** :.   *: .:..*: * .              . ::     : *:.     :        * 
qepvscravvktisv  lkqlnd vekngs eg vslay-gnvvsqgrtsqtsfnnvvgla vslvlglilvsivaqk l
        ls e ad  e nkk  iae       cni hnfdesdpe smknmkfa    mggt fa igmff k   
                   hie              f f a     d  f    k         a     a         
© 1998-2022Legal notice