Dataset for protein Bcl2l10 of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         ***********************************************************************
---------MADPLRERTERLLADYLGCCAREPGTPEPRPSTPEAAVLRSAAARLRQLHRSFFSAYRGYPGNRVELVALM
tveslrgrt                                                                       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
AEAVLSDSPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRSFQPRLKEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQG
                                                                                

       170       180       190       200   
....:....|....:....|....:....|....:....|...
*******************************************
GWDGFCHFFRSPFPLAFWRKLLIQAFLACLLATAFGYLWTRLL
                                           
© 1998-2023Legal notice