Dataset for protein Bcl-xL of organism Papio anubis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                        *: ..  . :*             
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpm hltdlpaqk atghsssldarev

        90       100       110       120       130       140       150       160
                :: *:* ....::::    *********************************************
ipmaavkqalreagdefel w pafpdlashlhit                                             

       170       180       190       200       210       220       230   
© 1998-2020Legal notice