Dataset for protein BCL-2-like of organism Monopterus albus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
       . .   :   : .                                                            
 nmrqslkv grkmche mski stnhvrpnnmhggseteptfapgdslrrtknnvsgnptlpte               
 aiie  di dk   c    dg aqgghglgeegcand diqa ee linl fggtr gnsekr                
  cec                     f deedada          a hadg cea g ad  a                 

        90       100       110       120       130       140       150       160
                                                                      .:    :.  
                                                     ssqkqptrsknietmhe m elgnd
                                                     hach l qrdmhd i a   ca e 
                                                       a    ngag a              

       170       180       190       200       210       220       230       240
  .   : .:               . .* :.:. **  ****: .:: * ..:.     :      :            
yqhtqritsmhrtf---espdpqrrvkk iqslvk  tt    vigfle taavaryltaqnertnqlspgqgqelgqgp
tlfkpm nk aqd  vqcrg dmqflge ae i g  hl     ta      tm qq k  en keg g           
ra agd he  l   kl gd  cn  e       a                       a     e c e           
    a      h       a      a                                                     

       250       260       270       280       290       300       310       320
     : : :: **      *:  :..*: * ::            :  :       .      :               
gncrlvvqtist  nspqrd lvnqna er vkfygvsqpaavnsttwps--rvfgvavtgaaslttnnttsglkrsysr
    klgde am  lnelqs  lk   c e isd qan vthds vmalrklaal ml vllirfllecg vierwqi
    e      e  gg kn    g     a c     a a  sf c lk iagf  i g               c kelf
           d      k                                 a                       a ia

k rl
a pd
© 1998-2022Legal notice