Dataset for protein Mcl-1 of organism Monodelphis domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160

       170       180       190       200       210       220       230       240

       250       260       270       280       290       300       310       320
                                                                             k k
                                                                             e f

       330       340       350       360       370       380       390      
leqfprgdtrt dpcapssaylllirnv-lwwcqvtgv-chvpylp-nvlteerkwaaslqrshnkfstsmithgl
eaf heeale              caep fafaglaas agladki                              
© 1998-2020Legal notice