Dataset for protein BCL-2-like of organism Mastacembelus armatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------mllvvaafivafvlllymisplispkplklngahvvvt-------Ggssgigk
msseeslsstitdwlfinswwlllpfi--trrnrllpgvyivyklsqvnyv-vhydsrdpstqt-ldsrngn--tanpkr
  cg           wketla amsy ps-----e--e-mtshpqdgr-epw--------qnrfn        s-----p
                       ed   tsysdl-vy-l- k -----q-gtsypsvseqnm--e        dvvespe
                            mnsq  w  vkl c cctkkgs-lplirpqaeggand         mtaaaa
                            amll  n  d f            ifhnee  df            e     
                             hec                    g  e    aa                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                       :        
ciaiecyrq---------gafitlvardetkllqak--k-v--f-i-dk---lcisvdvssdynqvesvikqaqeklgpv
tknl---vthqarfhsltntyaskspvaspsspelqfh-e-ek-a-n--qvv------s-ap---ikeavresdteqerl
pv--lvssn         sgrvkttiptpsddi-dg   t yn l qslpctpelqsq-e--scaagdelldnanrfllc
eqrqkthar         rr ngsrggmdem--y--           vv   qvwvlpqtgsvep------nghlnw ir
 ng ame           qc laqc    cgpfrsv                  rhylprdgqd  hrl v  gd     
 l                   d g      ai nrr                  eg   h  la   f  a         
                               c lkc                          f    a            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
dmlvncagtsvsgkfee------------vevdrfkklmevnylgsvyptra----------------------iglfgy
yyrkfvslsrqlrwtpskgmkpgldsgkgtalstmpsvvd------------vittmkerrmgrimfvssqagq------
qtqadsdmlnkpylhdt            k yrsger---evfrdg nwg i                      vaf af
vspfttt vlsrqimsq            q qqq aestr l k                                  e 
fq d fe h   h   d               h   -iim                                        
 a          d   a               g   i c                                         
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tayspskfalr-glaeslqmeikpyniyvtvayppdtdtpglaeenktkpletklisetsgvcqpeqvakivvrdavqgn
-----------eems--------wmt--l------wi-------------------------------------------
ggllcvectyk --inlvsridr---vr-vstvak--qsq ttnwgri    as vafgav          ylkekgr d
dlvekyryven n -sk gldaegddm fdnhissslfad                                    i   
  tv    ia    tpq dn vd   l  ngpln   edn                                        
  a           fa          e   e  e                                              
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
fnssvgpd--gymlsaltcgmspvtsitealqqi----------------------rtialfylg-----------sfds
--------is------------------------itmglfdrqresvfscswpsikkfvlfarvaeekkdwlqendlpeg
cvel  qe  twlhfderfwrvknnewrrsqetlafvemy                gvweg-gmt           gati
            dc vqiddldaaavsdc wpsf                      trfgdvaal           dws 
            ea   my qqres fs    nd                      ek f l              ava 
                          a                                                  l  
                                                                                

       410       420       430       440  
....:....|....:....|....:....|....:....|..
                                          
ivrrcmiqreqsksad--------------------------
ttigtlmavk------kreallisynvvmltstsllvrpvsa
vlvhsyttqahvtglpatl  faargnklaglqfaisa    
fikfyhs k-gdaasgmkt     acgg              
 cgav l   vlhd s                          
    a     r                               
                                          
© 1998-2022Legal notice