Dataset for protein BCL-2-like of organism Mastacembelus armatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                     .   :     :                                                
                 -nsqwknt alfek ----k-----y------qn------------ngllthlvrtcrgtrtv
                 smgl   i  ka d    k-g vwifinvqeqdaand svvesppeqria   slcfndpqs 
                 acec         c         lg hel  e      geaapg          g    a   

        90       100       110       120       130       140       150       160
                                                          .:.   :.:   .   :  :  
iedp plrqergl-----                                  -aeshrv  elgnkm erhqrr ts tr
td e i qlch   tasp                                  q  iae   ca d    q apd he hq
   a          q dl                                                      a       

       170       180       190       200       210       220       230       240
             .  * ..:. **  ****: .:. * ..:.     :      :                 : : :: 
klsdddrdddvhfvkt iksvvr  tt    vigfvt tatvsqyliaqknrgdclelgkgqelgqgpescrgvgqeism
tf yqcst pqsrlrk a  k  hl     aa  e   a  rq v  ee taq ds               lvdt al
   kl gp  cq  ee                              m     ksg gn                     e
   h   a                                    a                                d

       250       260       270       280       290       300       310  
**      *: .:..*: * ::            :          .      :                   
  lsdqrd lvkqns ec akfyrvaqraatashtlmalkgvagvavaglllilyngym-k--saisapvsa
  nnplns  ee   h c msh sap vvsds wps-a----- mlavas vvcsvtt-svr        
  ggekk    d     a     d q    sh c mkni-t f a lf     tranklltlrl        
      e                        f      f k            gl a  fl           
© 1998-2020Legal notice