Dataset for protein BCL-2-like of organism Mastacembelus armatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                        .       
---------------------------mllvvaafivafvlllymisplispkplklngahvvvt-------Ggssgigk
msseeslsstitdwlfinswwlllpfi-strrnrllpgvyivyklsqvnyp-vh----d-stqt-ldsrngnsstanpkr
                       mscgp-setllevyeymtshpqdgr-egw--ydsr-p--rfn        evvaapp
                           lwnysd waedllskc-----s--tsyirvqeqqn--e        dmtesme
                            tmsq  n  vkf c ct pqgvvlplhnpe engand         e   aa
                            mkll              kk    if e    gf                  
                            ah c                    g       da                  
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            : :                 
ciaiecyrqgafitlvardetkllqak--kevekfaindk---lcisvdvssdynqvesvikqaqekl--------gpvd
tknl---vtngya-kspvasps-----fh-----------qvv------seaps-a--eavresdteqellytrafsils
pv--lvssn----s--ig-d-ddpelq  htaynhsltslpctqelqsp-----c-ikdelldnanrf rrfqqd ldcq
eqrqktharstrvgtt--t-s-siydg   q rf l qvvflkpvwvlqqtgsvkpag-- vnghlnw    ap  trmv
 ng ame  rr nasrgpmpempfnsr           qt     rpylprdlrev hrl a  gd           e h
 l        c d g      gi lrc                  ghd ch gqd   f                     
                     ac                      eg      la   a                     
                                                     f                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     :         .   .                                                            
mlvncagtsvsgkfeevevdrfkklmevnylgsvyptravittmkerr-grimfvssqagqiglfgytayspskfalrgl
yqldvtpltayrwhdskmdevmrdgvn---------------------m-----------------------wi-s-g-w
s kyissvlkpqsmkq alstgl----wgriiglfafggtlcvecvekeemssl grivewmtmylddllek--y-y- -
r ftl  d srhr a  imkp  rvgkgqe vaf e   av    ia  n tpq dn  d   e  nnhinsyrqtqn m
n  hf  a  q l    g  l   s                    a      a              gp  qgpedn   
                                                                   e        c   
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
aeslqmeikpyniyvtvayppdtdtpglaeenktkpletklisetsgvcqpeqvakivvrdavqgnfnssvgpd--gyml
--f---------------vgrslfad-ttswgri----------------------------------------is----
in-aelddrgddvrfvstfak-aa-ewrrnqe--    as vafgavf kfshs reylkekgr dcvel  qe  t l 
dhkvsi          ad---q--s-s-----tw           e            sh ss                 
ecti               lqerkkvfsq npsl                            i                 
 a                 dg ee  a c  dnf                                              
                                g                                               
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
saltcgmspvtsit------itmglf----------------rtialfylgsfdsivrrcmiqreqsksad---------
--------------ealqqi------drqresvfscswpsikkkvlfaavalvtgttigtlmavk------kreallisy
 dqrdwlvknn wd     dafvemy                gfwegvratgpelvlvhyylvq-hvtglpatl     r
                                          tvtg lgmldasiailtv ttkagdaa g         
                                          mrff     alg  ggas     rl             
                                                     a     f                    
                                                           a                    
                                                                                

       410       
....:....|....:..
                 
-----------------
nnvmltsqsaisapvsa
cgk              
                 
                 
                 
                 
                 
© 1998-2022Legal notice