Dataset for protein BCL-2-like of organism Loxodonta africana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfgfkrnaviglnlycggaglgaggcatppggrlpapgkeatarqevgggdagasppaavyphvsrvvrtlpigmahpgv
                                                            aidgrlsslpaaaaaqgasr
                                                                          rmatpa
                                                                           e  d 
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                       *:                                       
taydnrelvfkyi-------------------------hYklsqrgy-w-----------------------p-l----p
-g-patpilmdfvrrtsppvemnasvaeaimspeeelgg epetly-e-sqfsdveeeageasegtkrpavl-v-vlvg-
s-t-t dtfvastpca   e ae la d    a    d-   vpk lvy        nrtg  aappsempi svqssqe
msqsm ameagpl                         s   r d  sc                 ega ef ralnpp 
  p    c                              r        k                      aa l iign 
  i                                                                      g g    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                              :                                                 
a-----ttrvlpstappaaqpalspyp-pvlhqtlr------------------------------ragdgfsrryrrdf
-snspgd-gts-lq-dsveeeeeklvrmqsvdlivvylqeqatgatqtrqmggsgaasrkavrtlrqva-evq-n-eta-
saprsp-s---q--q--ssldvdevlk dp kias   h   i  kdgkple         len p--- d-et-h---s
 rhlgkspasngnvphlgqk grgnia ac enfm                               e   - -l f  v 
  ggad h a  a gf   g     a   a    f                               a        e  t 
   c   d                                                                        
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        ..       :  .    * .*  :***:*: : **. :      :                           
sgmssqlhitpgtavqsfsqvveelFrdGv-nWGRiVaffsFGgvlc--vesvnremsplvd---nialwmteylnrhlr
qellrk-dlknfsdrkrlatamvhv sg itk   l t-ie  afvvkhlkllrqrsave--tyktvvesvavvivdtth
ad----p-vsien qgi tr snke q  pi       l v   ami  kg idk iridcs   rlstlrvtfcltrra
-- ta    dd yt  kg  d   e           i a   i a  f    e aqa  i   qdqsfikr  e nke
   a                a                          a       e   g   p      d    k  
                                                                 k              
                                                                                

       330       340       350       360       370       380      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
         .: .  *                                                  
--------twiqdngGw--fv-l---g---------------v-t---g---vga--tl-------
ggdglvefdhvvssr ddr--e-yhy-tlesvrrlvpyswas-k-vlt-kla---lv--gqyyttk
        v lrqqq  vgttqflgvsp  nmkpnrlrvfwqtrlyvslav lqmclvvtawflsr
        p  kk  cen p fffng  ggikfielnglllfglga li cecfilek flgiq
        e  he    aa  a aceed  fa edfdga ig a ea   a     f      ah 
                         d a  e    eaf                            
                         a                                        
© 1998-2020Legal notice