Dataset for protein BCL-2-like of organism Loxodonta africana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     .   . ::   :                   *                           
-------------------rtgydnrelvmdylhy----------------kLsqrgyew------------a-------
yihvslssltlaaammhag-fsqsynaiivkfiycggaglgaggcatppggv r-k----tqrsevggeagg-spptpva
              rattpmsapktk-qlnvs                 r qa- kvcsafqd eenrte  egpese
                adcem fir    g   k                   p p  sa        gda   aaaag 
                   a         a   g                                              
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------gpdprtspaqadpaaqparssvp-pv---------------------------------------
ppipsvvssppsrpr--staagslt--------l-p--vkpealaadaimspeeeldgyepeplgkrpavfprlglvgea
megrralrpn ighlidqvtvngsrttsvsptv-f-pqmem                                       
ada g inga aaaeaag gei  kpsrsllnraevi  de                                       
                        aghff  d  a    aa                                       
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              :.   * .          
----------------------------------------------------------vhqtlrqagDefsrryrrdfse
sngpgtdgslpstpplaeeeedelyrqsleiisrylqeqatgakdtkpmggsgaasrklllamkrvl dve-----a-ad
                                                          akkn  pca n -tnhet- --
                                                           ee   e   g ql f  t qg
                                                                a               
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    : :.       :  *    * .*  ****:*::: **. :            :     :   :.  :      *: 
mssqlhitpgtarqrfaqVveelFrdG-vNWGRiVaffsFGgvlcvesvnremsplvd---nialwmteylnrhlhtWiq
l---vvlsnfsdqgsltt mnkv sg it    l tlie  aamikkllskrqevristykrvsesvavvivdttad lv
-trk dvkied yti sr sdhe q   p       i v   ivaah krvniqsd g   qlqtfivtf etrkrp  r
 la      d  vk    a   e   i         a   f      de  a   e   p  s      n ee  h
 a                                                         k                  
                                                                                

       330       340       350       360       370    
....:....|....:....|....:....|....:....|....:....|....
.. **                                       .         
dngGW--f--l---g---------egsw-svkt-ltgkl-vgalvtl---y---
ssr  dr-ve-yhy-tlesvrrlr----w---ly-s-a-glqmclv-gqyfttk
qq   vgttpflgvsp  nmkpflpyvirqtr-vv-l-vacecgilvtaw-lsr
   ae  a fcfng  fa kdidrnglnll lfa vi    ffaek flgiq
    a      eed  e  e fafgfil f ea   a            ah 
             d a       e    a    a                    
© 1998-2020Legal notice