Dataset for protein Bcl-2 of organism Loxodonta africana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
***********************************                        *********************

        90       100       110       120       130       140       150       160

       170       180       190       200       210       220         
*************************                              ****:.        
                         dafvelygpnmrplfdfswlslktllslal    itegaylghk
© 1998-2020Legal notice