Dataset for protein BCL-2-like of organism Lonchura striata domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             :. .:: * *.:                                                       
------myssnrelvidfvsYkLsqkgyswsqleeedenrtdf---------ageedemdgvlngspswhaatshivnga
mamptrrgyyvyyiaqkylq v qe------------------sasaaaaia----------------------------
  hegaef d     l  ih     r  d aag drvslpp h          agtsdht lvsph e        pp s
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           :  *   *  .**  ...:. .    .  : ..: ::.  .*   *  *::* * ** .*****:::* 
tvhqsslevheirrAad-VrqaLReagdefelryrrafsdltsqlhitp-stAyqsFeqVvnElFrDG-vNWGRIvafFs
---------shlgp qtv hlv  tmasslsrqtqedvrqmsgridlssvfv rsr vg me k a  nt     mti t
atashtppaeg    pqr ah       qd  e    p l      a  kri na  d                 e
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*** :  :   . :   ..    *  ::* *:  :   **: ****:  *:  : .                 ::   : 
FGGalcvesvvkemrvlvk---rIvswmTtYltdhldpWIqeNGGWer-Fvdlygndaaaemrkgqetfnkwlltgatva
   vmtkklqnrgvqptaeeken syfi e inrnkhn  dd    dng ltkferrs--------------wislsrit
   l      eh  fl  d   e at      in  ae   a          nm       rpl dfs   fk  l
                                                                                
                                                                                

       250       260       270
....:....|....:....|....:....|
.:.:                          
gvlllgtllsrs------------------
slvivsssitlkyytrsvprwrarglalah
a f alvrsfigprnghkca g        
      ad cceclla d            
       c    a                 
© 1998-2020Legal notice