Dataset for protein BCL-2-like of organism Lepisosteus oculatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
    .    . . *                              :   : : .*  :.    .            .. : 
-snsklprssani tqlycpnattihpglaslgpcpggsaartavlhpmsqag seeqlrnsseegvptsgwvpksarss
 alneak dn da ik                             hd     d  efdle a dpannali    e l

        90       100       110       120       130       140       150       160
 .*       . ..   *. * .          *:     :                                .*.   :
pp splgghqpesgeng gl sspq--ldcgsv egieelqkqlnaetreligtflqmytglphrrsrgkalet kesgn
 a  kaaeefaa  aad ag  p d         dfha a                                 a  daa 

       170       180       190       200       210       220       230       240
..   :   :  :  :* :       .*   * ..:* ** .*****..:. **..:. :  :    . *. :.: :: *
sivlmhhidyhelidk eienkgerrk veg mesv s  kt     agfve  atmakqmkergrsnl envgnaisn 
 f ak g   ad  a   f  a  dq    a a             a  a   al   dk  e c da  e   e 

       250       260       270       280       290       300  
*    . *: .: *** *.*::  :       .  *       .   .:** .*  :  .  
 lnnlrn llnqr   g a iyrrergsmysrdqp lirnfglgfllat  ta lailkrrl
 dgdi e   e     a    kdaaaefrc  f kfa a aa     g  fai   
© 1998-2022Legal notice