Dataset for protein Bcl2l10 of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160

       170       180       190       200       210       220       230       240
*** .                       :  ::. *:. .*  *    .*   *:..::      ::             
   dgtrrtpghgagraagkrprgwhgwfchffqd fpla le qagpa lsc lnnafhllldriimsfktfnpllpaq

© 1998-2020Legal notice