Dataset for protein Bcl-w of organism Heterocephalus glaber

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************************************************                
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGW----------------
                                                                aeftalygdgaleear

       170       180       190    
....:....|....:....|....:....|....
             * .   :***:   .  *.* 
-------------LtsrvkmGALvtvwgsfAsK-
rlregnwasvrtv igagal   igggafc g e
© 1998-2020Legal notice