Dataset for protein BCL-2-like of organism Dipodomys ordii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             : . * *..:                                         
---------------------------asapstRlLvad-----------------------------------------
mfglrrnaviglnfycggaglgamstp-msqgn e tveeasarreagggeagagiggsagaspsttlapdarrvarpap
                       gaga a  dg a                                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                               :    * :.                        
-----------------------------------------------fvsykLsqkgy-------v-e------------
igaevpdvtgtptkrvffapthraptpdemeaaaagaimspeeeldgylpep rkrpavwsqlsl-g-sstssrtgtssp
                                                eg   g    slplfed e arkedpedgele

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    :       ...:.                :::* .** .: ..  :*..:  :* :.   
---p-a--------------vcryltgqstsak-------apvk-----qalRraGDefetryrraFsdltsqLhitpgt
stt-s-ingnpswyrqsspiivnggrehgsgsedrkvlpm-glhsrkaletm ev  gvqrnhett qgmlrk dvknes
mep p eeeddelhladlea  gaap eapa daaepigg aaa         a      l f       aa       d

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  : : .*   :* .*  ****:*::: **. :.    . : :  :  : . :.  *      *: .  **  *. ::  
ayqsftqVvnelFsdGv-NWGRiVaffsFGaalcvesvskemevlvsrvaewmvtyLvttlrdWivssgGWdtFvelygv
dvkrlsr sihv rg pt    l tliv  gfvakhlkninqqscigqlqssitdv nrrkep lqkqr  ag taffhn
 q   e  md   q                    a   d     epi    a edh a   he   e      d

       330       340       350       360  
....:....|....:....|....:....|....:....|..
             .    .  ..:*.. :*:       :  .
nalee-r---e--gswrsvrtvvaGvvllGal---g--fssk
gdaa-s-rlr-rfnrifntlmtlt aagv s-vtv-lfylrr
e    a kgq    n al glaf    a        aa ai 
© 1998-2020Legal notice