Dataset for protein BCL-2-like of organism Cynoglossus semilaevis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                 i lmp  lspmeec  keik iakh  acglwkws ag gdgdnq e
                                         gmlac   e  e   cd     gf vh         d a
                                         cl         c              e            

        90       100       110       120       130       140       150       160
                                                              ::.       .:    : 
-d--t---ivs--t-lvpvvrgt-tatppdsipnrqqrsv                sstshssvhelakemgnqlqrl t
e-yvstccesrvsqpashtlqhseg-p nag  llc hpp                ape  e   a  q iek   h  s
  alnnaa qgt ah pgrcn c                a                 d   d        a     a  a
    g    n      na    a                                                         

       170       180       190       200       210       220       230       240
    .:  :           .  *  .:. **  ****: .:. * ..:.                              
tafsnmlrqlgltpstayvsftn mdevvr  -v    vvgift tgalsvecvvkeglkpgqepeagqelgpepgtmse
rlsrsfhqkcyvysd vqrvvrk ir      hs     iaf e     akq lqrnd                   wtq
qd qe ff  hsena  iqrlke  e       l                   aaqk                    lrp
p   d     di     chc ga                                                      c  

       250       260       270       280       290       300       310       320
 .  :      **      *:  :..*: * *:              :.   .  .                        
lvpriadwmt-  depikp iqeqgg er a lygtq--arsrsswssvktwllagatlvaavvigv-itqkvwaftvaf
tadq vq---v  nnhlqi  kt     h c isqsdgiskfsccrp mrrvvfl mswllsltvmsyfrsirl      
q at     am  ggekna  es     a     hr-eepeel qqe i kf  f  gvg gg tflwvnrfhk      
          e      d                dq ca  ai  dd f  a              asrlk g       
                                   g a                             dlk          

© 1998-2022Legal notice