Dataset for protein Mcl-1 of organism Colobus angolensis palliatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************                                            
MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL--------------------------------------------
                                    atekeasarreigggeagtviggsagasppaaltpdarrvarpp

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pigaevpdvtatparllffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvgesnssstdgslp

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            ***************************************** :  :      
----------------------------ATGAKDTQPMGRSGATSRKALETLRRVGDGVQRNHETAFQGwvrkv------
stpppaeeeedelyrqsleiisrylreq                                         mlcgldikned

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           : . *  .*                     ::.*   :. .  .      *.*:               
-----------vpsrGvtrW---------------------qqsCieplcrsiws------RsWl---------------
dvkslsrvmihlfcd prn grivtlisfgafvakhlktinhek aagfaecctdvlvrtk d fvkqrgwdgfveffhv

       330       340         
....:....|....:....|....:....
                  *:.  :* *  
------------------GvsnqlAyL--
edleggirnvllafagva igagi l ir
© 1998-2020Legal notice