Dataset for protein Mcl-1 of organism Cebus imitator

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************                                            
MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLatekeasaqrevgggeagaviggsvgasppaaltpdarrvvrpp
                                    --------------------------------------------
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
pigaevpdvtatpsrllffaptrraapleemeapaadaimspeeeldgyepeplgkrpavlpllelvgepgngsstdgsl
--------------------------------------------------------------------------------
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                             ***************************************** :  :     
pstpppaeeeedelyrqsleiisrylreqATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGmlrkldikne
-----------------------------                                         wvcgv-----
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            : . *  .*                     ::.*   :. .           *   .*.* *: : : 
ddvkslsrvmvhvfsdGvtnWgrivtliyfgafvakhlktinqesCieplaesitdvlvrtkrdWlvkqRgWdGfveffh
------------lpcr prr ---------------------hqk aagfcrcc---------- ---s s f isnkia
                                                                                

       330       340       350     
....:....|....:....|....:....|....:
:                                  
vedleggirn---afagvagvgaglaylir-----
l---------vll-----------------krkrs
       dcs   dh t lqp nrarf lk     
© 1998-2021Legal notice