Dataset for protein Bcl-w of organism Carlito syrichta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
     .* . . *  :.      :*    .. **: **.  .: : * * . .:   :. :  * .:* *::*   *...
--meee eklke qnev------e qmnmspp  na  vimsieek e darsiyvgnvdyga aee e hf --- cgs

        90       100       110       120       130       140       150       160
 . . :  : *.* *   . .*:: *.   .. :     *.*.   * .::.   .* .                     
vnrvtilcdk s h ---kgf yie sdkesvrtslald s frgr ikvipkrtn pg---------eleaikarvrem

       170       180       190       200       210       220       230       240

       250       260       270       280       290       300       310       320
                                             :  . *      * *  *: * *: : ...     
ghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgtalygd aleear l eg wa v tvltgav-----

  .  . . . ::::. 
© 1998-2022Legal notice