Dataset for protein Bfl1 of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*. *   .  ... . .  :  **:: *.***************************************************
MspL---syrgrrtsvsrslplVGwmtLwPTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRASGSSRGTRLP
 ch fgggrdaqkcggeprfca  flf k                                                   

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
SRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASRVLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFN
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
QVMEKEFEDGVINWGRIVTVFAFEGILTKKLLEQRISSDVDAEKVSYFVAEFITRNMRDWIRQNGGWENGFVKKFEPKSG
                                                                                

       250       260  
....:....|....:....|..
**********************
WLTFLEVLGTVCEMWSHLKQYY
                      
© 1998-2022Legal notice