Dataset for protein Bfl1 of organism Canis lupus familiaris

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               *****************************************************************
---------------MSHLFGGSYDAQRCSGERRLPAVGFMFLWPTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQP
msmiqecasllgrnk                                                                 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
RPHRASGSSRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASRVLQDVAFSVQGQVEKNLKPCLD
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
SFDVVSVDTARTIFNQVMEKEFEDGVINWGRIVTVFAFEGILTKKLLEQRISSDVDAEKVSYFVAEFITRNMRDWIRQNG
                                                                                

       250       260       270       
....:....|....:....|....:....|....:..
*************************************
GWENGFVKKFEPKSGWLTFLEVLGTVCEMWSHLKQYY
                                     
© 1998-2023Legal notice