Dataset for protein BCL-2-like of organism Cairina moschata domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                  :    :  *  .                  
plgdlkhqssrsltflktwrclgrvvagvfcrgnlteehiyspk-syl-mnlllgfvl ygggrypqgggggggggggpa
                                            rgsgp  iaef nh a k lg             
                                             fad   a  d ia     d  d             

        90       100       110       120       130       140       150       160
                                                   :   *.                       
stggtpappppsphaaappppfpaargapcslligsaaaprsligsaapplyvpl sl-pnr--v-pg-p--gln----w
                                                    alg dhagcppalelegdggagg tlpr
                                                     ae  e eae  a aa a   aa    g

       170       180       190       200       210       220       230       240
                                                         :         .**  .. .  . 
----lptdelrqdslelilrylreaagetepgl-qvvs-lpvr---v-vs-l-qsk-vg-aqtvvhlv  qvassvqlqt
tr e                             kkllpphlgprsslegrdgppgea eq ppr aht  ni  gllekh
                                   ffn aaeh   a ag a mea                  ed  

       250       260       270       280       290       300       310       320
   :  :  .: :.        .  *    * ** .****:.::: **. :     .            :   :*  :  
rldlrpltrrielksgdvdrrrvng mehk s  vt    vtalit  alvtrklqnrkvrptgekkerlvyii taisr
qe  qgfsgk d  kf e lgi ge ad   a  n        i e   fmakh kekgqqls   idq srf   nn
    ad  d      e   k a ea  a                     a      dh  ek                id

       330       340       350       360       370       380       390       400
    *:  :***:  *:  :                  :::   :         : .:                      
skhp lveq   dng ltkfrvrmrplmrkswi-lrtwimtlvlitdvitsvssmiheyyagriargpmriialgaesgr
n dn  dd       ef eredaaefdflqgtinnv  agsk gacglalfl g  ac                    
  a    a            da      gee fkk      g    fa     f                        

       410       420       430       440       450       460       470       480

© 1998-2023Legal notice