Dataset for protein Bcl-w of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mgtvlfsghplqgwksstsawnvrdllemlnllqgfmrpsrllftasrvrspawplmpswpcsswppaalffpelwlfps
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                               **:.*:*. : . ... 
---------------------------------------------------------------MAtpAsApdtralvadf
lrpspaplsgrisgphhhpapgppsrppfllppsfppflpvslppssctrkqpdpgsgltpar  aa a aaaagaaggr
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .   *..  * ***  .***.....   .    .:*:*.      .:*  :    * . ::     :     *.*. * 
vgyklRqkgyVcGAG--pGEGpaadplhqamraagdEfEtrfrrtfsdLaaqlhvtPgsaqqrftqvsdelfqGgPnwGr
gsgpg rrhl p   gea   apggagdygnglese l p------ee llepepe epeeepprprap---p a gp p
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       *:.  .:. ::* . **      * :::                                             
lvaffvfGaalcaesvnkEmepLV------Gqvqewmvayletrladwihssggwa------------------------
------- sgapgnqeee esg  egdpgd aiedp--------------------sqtseaemvhevffgeilsncdsa
                                                       f                        

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       *: *: .      *** .*.*               ** ..*            *:: .* *  ** .     
-------EltAlyg--rgmlEEArrLrE---------------GNwgsV------------RtvyvGnVdyGAtvtv---
psspvpe fe ikarvdeae   ek k lqnevekqmnmsppp  aap imsieekmeada silt a al  laeelea
                v                                                               

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
hfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrart
                                                                                

       490       500       510      
....:....|....:....|....:....|....:.
                   * .: .           
-------------------Grvyrsk----------
tnynssrsrfysgfnsrpr affagraratswyspy
                         g          
© 1998-2022Legal notice