Dataset for protein Bcl-2 of organism Ailuropoda melanoleuca

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
     ... . * :* .            *:.. .: *******************************************
mahaghpaadn ef mkyihyklsqrgye daadaap                                           

        90       100       110       120       130       140       150       160
**************************************************************************** .  

       170       180       190       200
e egpsmqplfdfswlslkallslalvgacitlgaylghk
© 1998-2020Legal notice