Dataset for protein BAX-like of organism Chlorocebus sabaeus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
        .  .             .:.:::      : . ::  *  .            *     .    :   .:. 
mdgsgaslqrpsvprq-imepflr-ptekelmkqgeevgqgfihd hlqeqlsws-peped vmdrdavpqdstmkqvse
      qg  g  faa cgdaadp a d  iaadaaa f e  fa ag a eaeg aag a  lal  lepc slg   d

        90       100       110       120       130       140       150       160
 *  *  .:  .   :           . ..   *  :*. :*. * :.**.**:*  ..  *.:       . ::  : 
e em rpelnsrvdrelmtmavhlq-vtenpy-y lki ghl ed nft  k  s lgvgsk vvhcvqqgqtellhhlt
c ai   di mal fh a  d e tadr v fa  adi  a           fa  ag   dalchal afigaim

       170       180       190       200       210       220   
    :* :.  :  *:  .***   *.          .  :: .    . :     :      
gftle mvhhrilr lqqq   tdl nlvvstngplqshtlllglcslarltkrkkmkslper
dclg     ec  g  ad    daa kcf   d giln la g  f q liaa  gl    
© 1998-2020Legal notice