Dataset for protein Bok of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*    *:*: *.  . .::.  .  *                                                      
M----EvLrvSsvrphrlmsrpgrvPt-----------------------------------------------------
 cgpc l hr pplaaeildafdas cpqhlqphpaqmprsessskqexxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      : : *  * .* *.  *  *           .   .*.:*                  
----------------------elelVqqApgLtRrpyHrrLq----------rrrpsWstP------------------
xxxxxxxxxxxxxxxalasdlpdkdg al ka g efv ad lweafpcllwleaglg ga eraapvpggrlaevcavl

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :****************************************************************************
---tDELELIRPSVYRNVARQLNLSLQSETVVTDAFLAVATQIFSAGITWGKVVSLYSVAAGLAVDCVRQAQPALVHALV
lrla                                                                            

       250       260       270       280       290       300  
....:....|....:....|....:....|....:....|....:....|....:....|..
**************************************************************
DCLGEFVRKTLATWLRRRGGWTDVLKCVVSTDPGLRSHWLVAALCSFGRFLKAAFFMLLPER
                                                              
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice