Dataset for protein BAX-like of organism Capra hircus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                    ..:.:::      : . ::  *  .                    :    : .:. :*  
-evlrrssplgqeemepfgrpptekelmkqgeevgqgyihd hlqeqgetpelepedvppggrlkkpsetmkqlarq ev
 asgqgpgmdaa cddaddg a d  iaadaaa f e  fa ag a eaeg aalaa emdalha lcac g i    al

        90       100       110       120       130       140       150       160
           :::         :*     *  :*:.:*. * :.**.**:*  ..  *.:       . ::  :     
-rpsvy-ryasnlnaqrmieqpta npy-y lki sql ed nft  k  s lsvgsk vvhcvqrgqteflhqltgftg
 gddin nv refe m  haa d  aar v fa  aei  a           fg  ag   dalcqal a igaimdcla

       170       180       190       200       210         
:* :*  :  *:  .***   *.      .  ..  :. *    . :     :      
e mv ksilr lqqq   tdl klvvstnaplqshtlfl lcslarltkrkkmkslper
     er  g  ad    daa dcf   d gikn a  a g  f q liaa  gl    
© 1998-2020Legal notice