Dataset for protein Bak1 of organism Bos mutus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**************************************     .: *.:          .********************
MASGQGPGPPGQDCDEPDPSSTSEEQVARDTEEVFRSYvqyrpnslApt---------rsSSTMGQVGRQLAVIGDDINR
                                      efeaegaa asdpemvtlhpep                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
RYDAEFQAMLQHLQPTADNAYEYFTKIASSLFESGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLRRSI
                                                                                

       170       180       190       200    
....:....|....:....|....:....|....:....|....
********************************************
ARWIAQRGGWVAALDLGNGPIKSVAIVLAVVLLGQFVVRRFFKS
                                            
© 1998-2020Legal notice