Dataset for protein Bax of organism Anolis carolinensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
             * *.*  *..:*                                                 *.:*: 
maaaaadpgrsre e p da ats dqilqtgtvllkgfiwdrvqscgdseriqatlaelkesesricdpktkq qd lf

        90       100       110       120       130       140       150       160
** :**..* :* **:*..    * **:  *:  :*:** :****:*.:**** .::  :*   :* ** *: ::**:* 
  gd  dg md q  i qaqgkn k  fad aael a  tf    i af    ckliaql aica l  l edii  a e

       170       180       190       200         
:::**: .*** *************************************
fik  lan   a                                     
© 1998-2020Legal notice