Dataset for protein classical BH3-containing proteins of organism Ovis aries

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                 lekqmqepqcpcelggdqlpteegm qmskgasaalnpfgeafhrnsnl     e eshp-vq
                 fageeedd  ea   d pf  a  e  aqaa    ag      fa hg      d   dh gl
                                                     d      e          a        

        90       100       110       120       130       140       150       160
-rv-lhsrsssspsphrlemdldseeepmgtflglpqfvp nqmpvrs     ysrlsersrlsymnstkgs ldmefgk
 ip gf ihhpcga    ad  akaadefel       re llifaqp     chlge pqlgf hfdgd   e k cec
 a  f   a cad              d a           ffga l         e  dm de g         a ada

       170       180       190       200       210       220       230       240
            :                         :   :   .                                 
gipmgpqgdkqn pe                  lp-vn sqe qcs sqpnq       lhh aheghpnmmllqi lf 
f    ei  ell n                    k  l iaa g g ce ha                            
     d   cga l                                  a                               

© 1998-2022Legal notice