Dataset for protein classical BH3-containing proteins of organism Myotis lucifugus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
    qaqeefedde ehedeedsq                              adp  g cpqe kapgllkha psp 

        90       100       110       120       130       140       150       160
                                            .                  .    . :*. :.*:: 
vmlpcgvtqgqqrssyhndgyrsvlprsrhssy-t-tprkmdtsspqwshhegrsrsappnlwpaqrygqq qsms qlq
llgea hqeeppalfsgha aglpe     a m gkselgeapeqalrqdf              mqc lk    a n
                                f a kaedd     e a a               e            h

       170       180       190       200       210  
                       .  .      :                  
g fkkprq     rqkheqnpqqfllq  f lliln fgn meg g aa r 
     g p     mpeaa hanm          fhk a d d          
© 1998-2022Legal notice