Dataset for protein classical BH3-containing proteins of organism Mesocricetus auratus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------mecpreggqlqpav----erppglrpgap------------------psaqtelq----------------
makqpsdvssppdqqveespdd-fgsedge-qtq-lsllvpsavscgldepglsadtfl-sqqdcplsrlqlrppthtag
 lqsvfrqncgtnpcrssgeepflqvrrt- ---w-g-          cag rrrr-a-p----anydepstfelsvccr
    iapgmaasakhpalaaahaiaqlkss rpfsa-r               p aq-talrfpilplgeprqcmrrspq
        e  r  ae h   e e lg dr  i    n                   v  am  gagfcaheaadhnr d
                       c ca  d       a                       l    e   gd   ag  a

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                         .   .                  
----p------------------g--l-------------drspapmsgdkstrtpsppcqafnhylsema---------
pglr-isqgdpatqtlspaspsq-vs-ssgvsspyrsqvtqepqslfycnagyqltlsasfpagvpneaqpgmeeelspf
rp g swtegksstrsplrpfvprpm pprwlgniiifqqehmnrs------a-alr trvsywlwggcve         
l  a rlsp  rarprg fidgrqsk lcescegdfhadlpalelkvpsktv-migg rqs ttprdc eh         
g    pap              i dc a al        ea d g khrgse le    lr rdag   dd         
                                          a   ha ap        ha p  e   a          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------pe--w--r----ia-elrrigdefn---------------h-------w-q-l-lf---l-wrrh--------
rgsirqs--eq-qi-pevw--r-----a----esyrrrvnnrqhieq-qqhrqrv-w-v-q--ivr-vlnveenregvgp
  rveslqpgpadhqa iqygqq qcm- qqhgqfkglprpyledqdtphnpdmairvlfnrwlqn aslltrgsskst 
  qsanakhnl aa    r  ak    s klea  e     ksrqteqhrrqsssllrmyls msl p qinprqpeme 
  lc a aa         e          d            rag a  m  pap t ki n  gk f p gldkg    
                                                          i          d dg aa    

  
..
  
--
wq


  
  
© 1998-2020Legal notice