Dataset for protein Bmf of organism Equus asinus asinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MESPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***********************************************************************   .     
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQvqqn-----
                                                                       hgmgrnrvw

       170       180       190       200       210       
....:....|....:....|....:....|....:....|....:....|....:..
          * .*.*. ...**                                  
----------AwnGgEssnggGPr---------------------------------
wqtllflhnl lg d nrgda  gpasglrlpslkdkvlefwpnavvipvdwmgpta
© 1998-2022Legal notice