Dataset for protein Bim of organism Cebus capucinus imitator

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************************************************                      :* * : 
IFVRRSSVLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPTCQAFNHYLSAM----------------------vRrIgev
                                                   asmrqsqaepagmrpeiwiaqel e ede

       170    
....:....|....
.             
vv------------
fnayyprrislpsd
© 1998-2020Legal notice